DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxb1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001107970.1 Gene:foxb1 / 100125219 XenbaseID:XB-GENE-1018255 Length:322 Species:Xenopus tropicalis


Alignment Length:211 Identity:105/211 - (49%)
Similarity:130/211 - (61%) Gaps:24/211 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65
            ||||.:.:|.||||||||||||||||..|.:::|||||||:||||:||:||:|||:|||||||||
 Frog     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSQEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130
            ||||||||:||...:.||||:|.|||...|||||||.|||||||:|.:.:.       .|.:...
 Frog    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVMKSDH-------LAPSKAS 123

  Fly   131 MVTHYLDDQ--LTQMAFADPARHGHVLA--NASAAQMSPYKATPPILPTTVTQLPARPKR----- 186
            ....||..|  |...|.|....|...::  |...:|.|.:|.     |..:..:.||..:     
 Frog   124 DAAQYLQQQAKLRLSALAASGTHLPQMSTYNLGVSQTSSFKH-----PFAIENIIAREYKMPGGL 183

  Fly   187 AFTIESLMAPDPASTP 202
            ||   |.|.|.||:.|
 Frog   184 AF---STMQPMPAAYP 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 65/87 (75%)
Alpha_kinase 106..>194 CDD:295997 23/96 (24%)
foxb1NP_001107970.1 FH 13..101 CDD:214627 65/87 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 190 1.000 Inparanoid score I3761
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm9480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.