DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxl1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_012817795.1 Gene:foxl1 / 100038263 XenbaseID:XB-GENE-5880620 Length:406 Species:Xenopus tropicalis


Alignment Length:351 Identity:103/351 - (29%)
Similarity:145/351 - (41%) Gaps:127/351 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||..||...:.|:.||:||||:||||..|.|.||||:|||||.|||||||||
 Frog    50 QKPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPR 114

  Fly    77 NVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRV------KQLEKDISNWKLAAAA-------- 127
            ...:.||||||||.|...||||||:..||:::.:.      |:.:.:.:.::||.||        
 Frog   115 EKGRPGKGSYWTLDPKCLDMFENGNFRRRKRKPKPILCQEGKRHKAEAAEYRLADAACKGTTCKV 179

  Fly   128 --NT------------EMVTHYLDDQLTQMAFAD------------PARHGHVLANASAA---QM 163
              ||            :..:....|...:|:.::            ||...|.....|..   .:
 Frog   180 AGNTGQNGSQDAPLGRKPTSACEKDSAGEMSSSEDEGGSGDYIKTSPAPECHNQERTSGTYWNSL 244

  Fly   164 SP-YKATPPILPTTVT------------------------------------------------- 178
            .| :..:.|:|...||                                                 
 Frog   245 HPSFYVSVPLLSDQVTLSSKREGSQAHEQGNRLLACGAQGHLGAPSPGSNNEKAGATDANCKEAE 309

  Fly   179 QLPARPKRAFTIESLMAPDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPS 243
            ||..:..|:|:|:|:::....|.|       |.|:|...|:.|.|      .:.:||.|:     
 Frog   310 QLSQKSARSFSIDSILSRSDQSAP-------ECGAPAPPAVSKVP------EDNVAASYR----- 356

  Fly   244 FFYNGQYGNIPCYQKTP-----PLFH 264
                       |:...|     |||:
 Frog   357 -----------CHAAVPSPSLCPLFN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 59/87 (68%)
Alpha_kinase 106..>194 CDD:295997 24/180 (13%)
foxl1XP_012817795.1 Forkhead 50..136 CDD:365978 57/85 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.