DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxe1

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:324 Identity:97/324 - (29%)
Similarity:146/324 - (45%) Gaps:87/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSF 67
            |||:..    |||||||:|.||||.:|..|.|.|..||:||.::|||||.|::|||||:||||:.
 Frog    60 RPLQKG----KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTL 120

  Fly    68 NDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMV 132
            ||||||:||...:.|||:||.|.|.|.|||::||.|||||||:                 .|::.
 Frog   121 NDCFIKIPREPGRPGKGNYWALDPNAEDMFDSGSFLRRRKRFK-----------------RTDLT 168

  Fly   133 TH--YLDD-------QLTQMAFADPARHGHVLANASAAQMSPYKATPPILPTTVTQLPARPKRAF 188
            |:  |:.|       |:.:..:.:.......::.:.:.|::|:.:.  ..|::.....:...|.|
 Frog   169 TYPAYIHDTSMFSPLQVARATYPNTVYPNMTMSPSYSQQIAPHSSV--YYPSSSPAFSSAQPRVF 231

  Fly   189 TIESLM---APDPASTPNEGLVP--------------MEYGSPDAVALEKPPFNLPFNFNELAAQ 236
            :|.:|:   ..:.|..||..:.|              ..|.|........|....|::::...:.
 Frog   232 SINTLIGHSGSEHAQQPNRSISPEVNSTSSSSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSH 296

  Fly   237 YQLYFPSF----------------------------FYN----GQYGNIPCYQKTPPLFHNGPL 268
            .|:...|:                            ||.    |||.::..|..      ||.|
 Frog   297 LQMNQSSYPHSNAQLFGSASRLPMPTSPPMNSDAVDFYGRMSPGQYTSLTTYNS------NGQL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 54/87 (62%)
Alpha_kinase 106..>194 CDD:295997 15/96 (16%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.