DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxd7

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:258 Identity:93/258 - (36%)
Similarity:123/258 - (47%) Gaps:47/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            |||||||:|..|||:.||::.|.||||..||..:|.:||:....||||:|||||.||||:|:||.
Zfish    64 KPPYSYIALITMAILQSPKKRLTLSEICDFISHRFVYYREKFPAWQNSIRHNLSLNDCFVKMPRE 128

  Fly    78 VTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDDQLTQ 142
            ....|||:||||.|.:.|||||||.|||||||:.:..:..:                :.|..|..
Zfish   129 PGNPGKGNYWTLDPNSSDMFENGSFLRRRKRFKRQHFKFGV----------------FKDQALQP 177

  Fly   143 MAFADPARHGHVL----ANASAAQMSPYK-----ATPP---ILPTTVTQLPARPKRAFTIESLMA 195
            ..|.:.:...:.|    |:..|..:.||.     ..||   |||...|        .|:..|:.|
Zfish   178 SGFPNLSYGAYGLSASCAHLPALDVYPYSFHQHIGVPPVGSILPALST--------LFSRNSVAA 234

  Fly   196 PDPASTPNEGLVPMEYGSPDAVALEKPPFNLPFNFNELAAQYQLYFPSFFYNGQYGNIPCYQK 258
            .....:....:.|:..|...|:|...|..:....||.:.      ||... |.||.    |||
Zfish   235 KSFPQSQTVAIEPVTPGIACAMAPTSPYASSAALFNPVG------FPRML-NFQYE----YQK 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 52/87 (60%)
Alpha_kinase 106..>194 CDD:295997 20/99 (20%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 47/82 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.