DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Cb and foxl3

DIOPT Version :9

Sequence 1:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001182055.1 Gene:foxl3 / 100003253 ZFINID:ZDB-GENE-121214-362 Length:220 Species:Danio rerio


Alignment Length:217 Identity:78/217 - (35%)
Similarity:102/217 - (47%) Gaps:59/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNLSFNDCFIKVPRN 77
            :|.||||:|.||||..||:..:.||.||.|||.:||:||.|.:.||||:|||||.|.|||||||.
Zfish    33 RPAYSYIALIAMAIQQSPENKVTLSGIYEFIMKRFPYYRSNQRAWQNSIRHNLSLNSCFIKVPRT 97

  Fly    78 V-TKAGKGSYWTLH---PMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTEMVTHYLDD 138
            . .:.|||:|||..   ....|:||||:..|||:|          .|.|:.....||        
Zfish    98 EGNEKGKGNYWTFATGCESMLDLFENGNFRRRRRR----------RNLKMGLKEPTE-------- 144

  Fly   139 QLTQMAFADPARHGHVLANAS-----------AAQMSPYKATPPILPTTVTQLPARPKRAFTIES 192
                 ||.....|..|...:|           |||..|           .|::      .|:|:.
Zfish   145 -----AFISMDAHQAVAVRSSDSDSFMNTSHRAAQNKP-----------ETEI------KFSIDY 187

  Fly   193 LMA-PDPA---STPNEGLVPME 210
            ::: |||.   ..||..:..:|
Zfish   188 ILSTPDPLPAFRAPNSAIPHLE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CbNP_524496.1 FH 13..101 CDD:214627 51/91 (56%)
Alpha_kinase 106..>194 CDD:295997 18/98 (18%)
foxl3NP_001182055.1 Forkhead 33..119 CDD:278670 47/85 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.