DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FKH1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_012135.1 Gene:FKH1 / 854675 SGDID:S000001393 Length:484 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:65/228 - (28%)
Similarity:96/228 - (42%) Gaps:61/228 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQ---KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||..|..|.   |||.||.|:...||.|:||..:.|:||||||:|.:.:||.:...||||:||||
Yeast   291 PSDLSLDENRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNL 355

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNE----ELTAL 126
            |.|..|.|||:|..:.|||..|.:..:          :||           |.||:    :|:.:
Yeast   356 SLNKAFEKVPKRAGQQGKGMNWKISDE----------VRR-----------DFLNKWNAGKLSKI 399

  Fly   127 ANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGP--------------GVP 177
                      |.|.|......|.|:....:   |.|.|::..|..:..              |..
Yeast   400 ----------RRGASVTRQLQLHMSKFGEI---PAPESSSIDPRGIKAQKVKKSLQATSSILGES 451

  Fly   178 LPHVMPASMSGADHTNLADMGLTNLPALTSSEI 210
            .|.:....::|...|.      |::...|::.:
Yeast   452 APQLQRTQLTGQISTT------TSMDVTTNANV 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 40/87 (46%)
FKH1NP_012135.1 COG5025 1..484 CDD:227358 65/228 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.040

Return to query results.
Submit another query.