DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxk2b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_001922856.1 Gene:foxk2b / 798356 ZFINID:ZDB-GENE-030131-5310 Length:597 Species:Danio rerio


Alignment Length:361 Identity:96/361 - (26%)
Similarity:150/361 - (41%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVP 75
            :.||||||..|...||..:|:|.|.|:.||..||..:||||...:.||||:|||||.|..|||||
Zfish   209 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVP 273

  Fly    76 RRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGG 140
            |..:.||||::|.:.|.:.......:..:||.|      ........|..|::.:.......:|.
Zfish   274 RSQEEPGKGSFWRIDPSSEGKLVEQAFRKRRPR------GVPCFRTPLGPLSSRSAPASPNHSGV 332

  Fly   141 SAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGP--GVPLPHVMP--ASMSGADHT-NLADMGLT 200
            .:||.|.:...::.:....|:|..:.  |.|:.|  .|.:..|.|  |.:.....| |.....:|
Zfish   333 LSAHSSGVQTPDSLSREGSPVPMESE--PVSVPPPAAVAVAAVQPKLAVIQETRFTQNTTASPIT 395

  Fly   201 NLPALTSSEIEGPLS----------LRPKRSFT--------------IESLITPDKPEHPSEDED 241
            ..|.|.:  ::.||:          ..|..|.|              |.::........|.|:.|
Zfish   396 TQPVLIA--VQRPLTQNMKPVTYAVAAPVSSSTSAQPLMQTVHVVHQIPAVAVSTVKTEPRENGD 458

  Fly   242 DEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHY------ 300
            .::.:|.::.|  .||        |.....:|:|..:|.....|:.|:......|...:      
Zfish   459 YDELKVKVEAV--PGI--------AHGSIGTANRVIQTSAAATPLQTVTIVQQAPLGQHQLPIKT 513

  Fly   301 --ATGANVAGLPASGIPNSPTTYELAISHPLFMMAA 334
              ..|.:|..: |:.|.:...|    :|.||.::||
Zfish   514 ITQNGTHVVPI-ATAIQSQANT----VSSPLHLLAA 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 43/87 (49%)
foxk2bXP_001922856.1 FHA 17..109 CDD:238017
Forkhead 211..297 CDD:278670 43/85 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.