DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxc1b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_571804.1 Gene:foxc1b / 79375 ZFINID:ZDB-GENE-010302-2 Length:433 Species:Danio rerio


Alignment Length:301 Identity:103/301 - (34%)
Similarity:140/301 - (46%) Gaps:68/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |:::.....|||||||:|..|||.:|.:|.:.|:.||:||.:|||:||.|.|.||||:|||||.|
Zfish    65 PAQQPKDMVKPPYSYIALITMAIQNSSDKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLN 129

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEE----------- 122
            :||:||||...:||||:||.|.|.:::||||||.||||:|||    .||:|.|:           
Zfish   130 ECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFK----KKDVLREKEDRDRQGKDNP 190

  Fly   123 ------------------------------LTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMR 157
                                          ...|:.:.:.....|:||||...||.......|..
Zfish   191 GQACEQDAQQPVKLRDIKTENGACTPPHDSTPPLSTVPKTESPDRSGGSACSGSPQSQTPQQAFS 255

  Fly   158 LDPL-------PRSTAHMPNSLG--PG-VPL---PHVMPASMS---GADHTNLADMGLTNLPALT 206
            :|.:       |:..|.:|.|..  || |.|   |...||..|   |...|...:|..|:|  .|
Zfish   256 MDTIMTGLRGSPQHAAELPASRAALPGSVSLTYSPTPQPAHYSPPCGQPATYHCNMQATSL--YT 318

  Fly   207 SSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRV 247
            .....|..:|....:.|..|.|:     ||.:....|...:
Zfish   319 GDRGHGDDTLPEYTNTTNASSIS-----HPHQSSSQESQHL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 53/87 (61%)
foxc1bNP_571804.1 Forkhead 74..160 CDD:278670 51/85 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..250 11/75 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..355 9/42 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.