DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxj1a

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001070174.2 Gene:foxj1a / 767737 ZFINID:ZDB-GENE-060929-1178 Length:458 Species:Danio rerio


Alignment Length:298 Identity:82/298 - (27%)
Similarity:120/298 - (40%) Gaps:78/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            ||||||.:|..||:.:|.:..:.||.|||:|||.|.|:|.....||||:|||||.|.|||||||:
Zfish   142 KPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQ 206

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            .|.||||.:|.:.||..:...|.:..:||                                    
Zfish   207 KDEPGKGGFWKIDPQYAERLLNEAYKKRR------------------------------------ 235

  Fly   143 AHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASM---------SGADHT---NLA 195
              :.|:.:|.|...||....::|..:..:|.       |.|.|.         :.||..   .||
Zfish   236 --LPPVQINPALQHRLRMNAQATGVISRNLS-------VSPESQQLLKDFEEATSADQNWDPRLA 291

  Fly   196 DMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDD------RVDIDVVEC 254
            :      ..:.|..|.|..:.:.|:.:...:..||.:...|....|:::|      ..|.|.:..
Zfish   292 E------ATMLSCWISGKGTNKRKQPYNHRTGKTPRRSSSPLLVMDEQEDLSSLRGNFDWDALLD 350

  Fly   255 SGI---------SRYPTTPAASEEYMSASRSSRTEDPL 283
            |.:         |....||...|..:..:..|..|.|:
Zfish   351 SALNGELSLNEGSPLSPTPQDEELMIRGTHISPQEAPV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 47/87 (54%)
foxj1aNP_001070174.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..99
Forkhead 142..228 CDD:278670 46/85 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..324 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.