DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxb2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001162056.1 Gene:Foxb2 / 691398 RGDID:1585019 Length:425 Species:Rattus norvegicus


Alignment Length:351 Identity:135/351 - (38%)
Similarity:170/351 - (48%) Gaps:75/351 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||||.:.||.:|||||||||||||||..|.|||||||||||||.:||||||::||||||||||||
  Rat     1 MPRPGKSSYSDQKPPYSYISLTAMAIQHSAEKMLPLSDIYKFIMERFPYYREHTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLN 130
            ||||||||:|||||:||||::|||||...|||||||.||||||||:.:.|...|:...:..|   
  Rat    66 SFNDCFIKIPRRPDQPGKGSFWALHPDCGDMFENGSFLRRRKRFKVLRADHAHLHSGSSKGA--- 127

  Fly   131 RFFFTTRNGGSAAHMSPLDMNNA---------AAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASM 186
                  ...|...|:.|...::|         ||..     ....|.|.   |..|.||::|   
  Rat   128 ------PGTGPGGHLHPHHPHHAHHHHHHHHHAAHH-----HHHHHPPQ---PPPPPPHMVP--- 175

  Fly   187 SGADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDV 251
                :.:.........|.|.|...:.|    |.:|       .|.:..||.:            :
  Rat   176 ----YFHQQPAPAPQPPHLPSQPAQQP----PPQS-------QPPQTSHPGK------------M 213

  Fly   252 VECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVP--------FLHYATGANVAG 308
            .|.:.::. ....||:....|..|.|:    .||....:|.|...        |.|.....|:.|
  Rat   214 QEAAAVAA-AAAAAAAAAVGSVGRLSQ----FPPYGLGSAAAAAAAAAASTTGFKHPFAIENIIG 273

  Fly   309 ------LPASGIPNSPTTYELAISHP 328
                  |.|.|:|.:...:.|....|
  Rat   274 RDYKGVLQAGGLPLASVMHHLGYPVP 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 73/87 (84%)
Foxb2NP_001162056.1 FH 13..101 CDD:214627 73/87 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3950
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm45170
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11829
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2160
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.110

Return to query results.
Submit another query.