DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxl3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_038945901.1 Gene:Foxl3 / 680273 RGDID:1594158 Length:216 Species:Rattus norvegicus


Alignment Length:100 Identity:54/100 - (54%)
Similarity:64/100 - (64%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            :|.||||:|.||||..||...:.||.||.||..:|||||.|.:.||||:|||||.|.||:||||.
  Rat    32 RPAYSYIALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRT 96

  Fly    78 PDR-PGKGAYWALH---PQAFDMFENGSLLRRRKR 108
            ... .|||.||...   ....|:||||:..|||:|
  Rat    97 EGHDKGKGNYWTFAGGCESLLDLFENGNFRRRRRR 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 49/91 (54%)
Foxl3XP_038945901.1 Forkhead 32..115 CDD:395192 45/82 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.