DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXL2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_075555.1 Gene:FOXL2 / 668 HGNCID:1092 Length:376 Species:Homo sapiens


Alignment Length:400 Identity:114/400 - (28%)
Similarity:155/400 - (38%) Gaps:140/400 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |.|:      |||||||::|.||||..|.||.|.||.||::|..:||:|.||.:.||||:|||||
Human    49 PDPA------QKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLS 107

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK-------LH-KNDKDLLNEEL 123
            .|:|||||||......||.||.|.|...||||.|: .|||:|.|       .| :..|.|...  
Human   108 LNECFIKVPREGGGERKGNYWTLDPACEDMFEKGN-YRRRRRMKRPFRPPPAHFQPGKGLFGA-- 169

  Fly   124 TALANLNRFFFTTRNGGSA-------------AHMSPLD------MNNAAAMRLDPLPRSTAHMP 169
                           ||:|             .:::|..      :||:.     |||:..:.||
Human   170 ---------------GGAAGGCGVAGAGADGYGYLAPPKYLQSGFLNNSW-----PLPQPPSPMP 214

  Fly   170 -----------------NSLGPGVPLPHVMPASMSG-----ADHTNLADMGLTNLPALTSS--EI 210
                             .:.|||.|....:...::|     ..:|.:..|.|.  |.:.:|  .:
Human   215 YASCQMAAAAAAAAAAAAAAGPGSPGAAAVVKGLAGPAASYGPYTRVQSMALP--PGVVNSYNGL 277

  Fly   211 EGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASR 275
            .||.:             .|..|.||                       :| .|.|...:.:|: 
Human   278 GGPPA-------------APPPPPHP-----------------------HP-HPHAHHLHAAAA- 304

  Fly   276 SSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHPLFMMAA----PI 336
                ..|.||.|    ||..|    ..|......||:..|.:|.    ..|.|....|.    .:
Human   305 ----PPPAPPHH----GAAAP----PPGQLSPASPATAAPPAPA----PTSAPGLQFACARQPEL 353

  Fly   337 ANMHNIYYNN 346
            |.||..|:::
Human   354 AMMHCSYWDH 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
FOXL2NP_075555.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53 2/9 (22%)
Forkhead 53..139 CDD:365978 51/85 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..342 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.