DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxg1c

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001038680.1 Gene:foxg1c / 571323 ZFINID:ZDB-GENE-050419-26 Length:379 Species:Danio rerio


Alignment Length:333 Identity:110/333 - (33%)
Similarity:153/333 - (45%) Gaps:66/333 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |.::|..: |||:||.:|..|||..|||:.|.|:.||:||...|||||:|.|.||||:|||||.|
Zfish    82 PEKKSKPD-KPPFSYNALIMMAIRQSPERRLTLNGIYEFIMGNFPYYRENRQGWQNSIRHNLSLN 145

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSL--LRRR----KRFKL-HKNDKDLLNEELTA- 125
            .||:||||..|.||||.||.|.|.:.|:|..|:.  ||||    .|.|| .|....|.:...:| 
Zfish   146 KCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTAASRAKLAMKRGARLSSTAASAG 210

  Fly   126 LANLNRFF-----FTT----RNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVP---L 178
            ||....|:     |.|    .:..:|||.|    |.||::    |.:|..|. :|:.|...   :
Zfish   211 LAFAGSFYWPVPPFVTLQHRHSSPAAAHHS----NYAASV----LSQSARHF-SSVAPAAERLLI 266

  Fly   179 PHVMPASMSGADHTNLADMG---LTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDE 240
            |....|:..|        ||   :|:..:..|:....||.|....||.:.|..:.....|     
Zfish   267 PSSQEATYYG--------MGCEQMTSSSSSFSTSASVPLPLSAPCSFNLLSNQSSYFYSH----- 318

  Fly   241 DDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSR---TEDPLPPMHTINAG--AHVP--FL 298
                     .|...:|:|.:    :..|.|:|.:..|.   ...|.|.......|  ..:|  |.
Zfish   319 ---------QVPHTAGLSAW----SQEESYLSKTSPSGQFFPGKPSPSSSEYIGGLCTDIPSYFP 370

  Fly   299 HYATGANV 306
            |:.|.:::
Zfish   371 HFNTASSM 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
foxg1cNP_001038680.1 FH 90..178 CDD:214627 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.