DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxo6a

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_690041.2 Gene:foxo6a / 561541 ZFINID:ZDB-GENE-110914-126 Length:594 Species:Danio rerio


Alignment Length:473 Identity:103/473 - (21%)
Similarity:183/473 - (38%) Gaps:133/473 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYR-----KNTQRWQNSLRHNL 65
            |.::|.|    ||..|...||.|:|:|.|.||.||.::....||::     .::..|:||:||||
Zfish    89 RNAWGNQ----SYAELITRAIESTPDKRLTLSQIYDWMVRYVPYFKDKGDSNSSAGWKNSIRHNL 149

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRK----------RFKLHKNDKDLLN 120
            |.:..||:|  :.:..||.::|.|:|:...:   |...|||.          :.|...|.|....
Zfish   150 SLHTRFIRV--QNEGTGKSSWWMLNPEGGKL---GKSQRRRAVSMDNGIKPLKSKGRTNRKKTTG 209

  Fly   121 EELTALANLNRFFFTTRNG-------------------GSAA------HMSPL------------ 148
            :...:...|..|..:..:|                   ||::      |:||:            
Zfish   210 KREQSTETLLEFCSSPDSGTGRIVVKDEFDTWTDLHSLGSSSTSTLSGHLSPILGEGELGEPEER 274

  Fly   149 DMNNAAAMRLDPLPRSTAHMPNS---------LG------PGVPLPH---VMPASMSGADHT--- 192
            ..:.:|:.||.|.| |:||.|.|         :|      |....||   |......|:...   
Zfish   275 RKSCSASPRLFPSP-SSAHSPASHCPTDLRATIGYKQHQSPCHKNPHYHYVSDIKSQGSSCETQP 338

  Fly   193 --NLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECS 255
              .|.|:|:......|:.:..|.:    :.:.||::|:|....:...|....:::.|...:|. .
Zfish   339 VYGLPDVGMHRSSIPTTEDNSGSM----QGASTIQNLLTTGPQQFVKEMMHGKENEVHSMMVS-Q 398

  Fly   256 GISRYPTTPAASEEYMSASRSSRTEDPLP-PMHTINAGAHV-------PFLH---------YATG 303
            |:  :|:.|..|.:.......|.::|..| .:|:.....|:       |:|:         .:|.
Zfish   399 GL--HPSNPNTSSKPFHNIIQSLSQDHRPTSVHSQPTDGHMQSYMHKSPYLYSPPVTVHLPASTA 461

  Fly   304 ANVAGL-----------------PASGIPNSPTTYELAISHPLFMMAAPIANMHNIYYNNVTLVA 351
            .|.||:                 |.|.:...|  :|.::::.|:.........::.|:::     
Zfish   462 LNPAGVQGIAQDTCHLATTPYPQPHSYVYTDP--HEHSLAYGLYRQPQGTGTGYHNYHHH----- 519

  Fly   352 PAQQYRSPEVQNRIDNDM 369
            |.|.|:...:...:|.|:
Zfish   520 PHQLYQHERLPADLDMDV 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 31/92 (34%)
foxo6aXP_690041.2 FH 92..172 CDD:238016 31/85 (36%)
PAT1 <390..>530 CDD:330585 26/149 (17%)
FOXO-TAD 528..568 CDD:318811 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.