DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxj2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_686801.4 Gene:foxj2 / 558490 ZFINID:ZDB-GENE-100922-240 Length:516 Species:Danio rerio


Alignment Length:383 Identity:106/383 - (27%)
Similarity:155/383 - (40%) Gaps:114/383 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            :|..|..|..:.|||:||.:|.||||.|:||..|.|:|||.:|:|.||||.:..:.|:||:||||
Zfish    45 IPALSPGSNSKVKPPHSYATLIAMAISSAPEMKLSLNDIYTWISDTFPYYCRAGRGWKNSIRHNL 109

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLN 130
            |.|.||.||||....||||:||.:     |:....:..|..||  .:.:|:.:            
Zfish   110 SLNKCFRKVPRPQSDPGKGSYWTM-----DVPPESTQPRGVKR--PYTDDEHV------------ 155

  Fly   131 RFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLP-----RST-AHMPNSLGPGVPLPHVMPASMSGA 189
                          ::|.......|.:.:|||     :|| ...|....|.:|:|..:| |...|
Zfish   156 --------------VTPFPETQLPANQPEPLPPQPDTKSTFPPPPCKQRPAIPVPSSLP-SNPHA 205

  Fly   190 D---HTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDV 251
            |   ..:.||:   |||.|.:|               .:||....:.:..|:.          ||
Zfish   206 DPPLRFSFADL---NLPDLYNS---------------FQSLCRSMREKVTSQS----------DV 242

  Fly   252 VECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINA-------GAHVPFLHYATGANVAGL 309
            ....|:: :.:||.          .:.|..||.|....|.       ..|:|.|:  |..|..  
Zfish   243 STLLGLT-HDSTPL----------HTPTLPPLSPCPNPNINQFINPNSTHIPNLN--TNGNFN-- 292

  Fly   310 PASGIPNSPTTYELAISHPLFMMAAPIANMHNIYYNNVT-------LVAPAQQYRSPE 360
                 ||:|        |.......|..| .:|:.|:.|       .|.||..:.:|:
Zfish   293 -----PNAP--------HSFIPTLNPNQN-SSIHPNSSTEPDKVLPNVVPADWFSNPD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 46/87 (53%)
foxj2XP_686801.4 Forkhead 57..134 CDD:278670 45/81 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.