DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxi4.1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_012818282.1 Gene:foxi4.1 / 549541 XenbaseID:XB-GENE-5996107 Length:381 Species:Xenopus tropicalis


Alignment Length:225 Identity:84/225 - (37%)
Similarity:115/225 - (51%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            :|||||.:|.||||.::|||.|.||.||:::.|.||:|:::...||||:|||||.||||.||||.
 Frog   129 RPPYSYSALIAMAIQNAPEKKLTLSQIYQYVADNFPFYKRSKAGWQNSIRHNLSLNDCFKKVPRD 193

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            .|.||||.||.|.|....||:||:..|:|||    ::|.... |.:|......|.....:.|.|.
 Frog   194 EDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR----RSDSSSA-EAVTVKGEEGRPALGGKGGESP 253

  Fly   143 AHMSPL--DMNNAAAMRLDPLPRSTAHMP--NSLGPGVPLPHVMPASMSGADHTNL---ADMGLT 200
            ..::|.  ::..|:..|....|......|  |:..          :||:..|.|::   ..|||.
 Frog   254 LMLTPSSPELEAASDGRKSTSPSGITSSPCLNNFF----------SSMTSLDTTSVNRQMSMGLV 308

  Fly   201 NLPALTSSEIEGPLSLRPKRSFTIESLITP 230
            |  .|:...|.|      ..|||..|:..|
 Frog   309 N--ELSQRNITG------LGSFTSGSVAEP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
foxi4.1XP_012818282.1 Forkhead 129..214 CDD:365978 49/84 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.