DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxi3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001102819.1 Gene:Foxi3 / 502846 RGDID:1561816 Length:400 Species:Rattus norvegicus


Alignment Length:323 Identity:93/323 - (28%)
Similarity:130/323 - (40%) Gaps:110/323 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRESYGEQ-KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |||...:. :|||||.:|.||||.|:||:.|.||.||:|:.|.||:|:::...||||:|||||.|
  Rat   122 SREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLN 186

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFF 133
            |||.||||..|.||||.||.|.|....||:||:..|:|:|             ...|.:||....
  Rat   187 DCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRR-------------RAEASSNLTVPS 238

  Fly   134 FTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMG 198
            .|:::.|.::.:.                                                    
  Rat   239 GTSKSDGQSSRLR---------------------------------------------------- 251

  Fly   199 LTNLPALTSSEIEG--PLS-LRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRY 260
                   .|.::||  |.| |||.:|        |:.||...            ......|.|..
  Rat   252 -------VSGKLEGDSPSSMLRPSQS--------PEPPEGTK------------STASSPGASTL 289

  Fly   261 PTTPA-----ASEEYMSASRSS-RTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNS 317
            .:||.     :|...:|.:.|| .|:..||.......|..:|        :....|::.||:|
  Rat   290 TSTPCLNTFLSSFNTLSVNASSMSTQRTLPGSRRHPGGTQLP--------SSTTFPSTSIPDS 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
Foxi3NP_001102819.1 Forkhead 131..217 CDD:278670 51/85 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.