DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001011383.1 Gene:foxd3 / 496851 XenbaseID:XB-GENE-487289 Length:369 Species:Xenopus tropicalis


Alignment Length:331 Identity:122/331 - (36%)
Similarity:169/331 - (51%) Gaps:62/331 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRESYGEQ--------KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSL 61
            |::..|.|        |||||||:|..|||..||:|.|.||.|.:||::||||||:....||||:
 Frog    76 SQQQEGMQNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSI 140

  Fly    62 RHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTAL 126
            |||||.||||:|:||.|..||||.||.|.||:.|||:|||.||||||||  :...|.|.|: |||
 Frog   141 RHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMFDNGSFLRRRKRFK--RQQPDSLREQ-TAL 202

  Fly   127 ANLNRFFFTTRNG--GSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPAS--MS 187
            . :..|...:..|  |....:.|....:.||::...:|.....:|    |.|||   :|:|  ..
 Frog   203 M-MQSFGAYSLAGPYGRPYGLHPAAYTHPAALQYPYIPPVGPMLP----PAVPL---LPSSELSR 259

  Fly   188 GADHTNLA---DMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDI 249
            .|..:.|:   .:.|::|.:..:|.|:...|.||  ||:||::                     |
 Frog   260 KAFSSQLSPSLQLQLSSLSSTAASIIKSEPSSRP--SFSIENI---------------------I 301

  Fly   250 DVVECSGIS-----RYPTTPAA---SEEYMSASRSSRTEDPLPPMHT-INAGAHVPFLHYATGAN 305
            .|...|.|:     |.|.|..:   |.:.::.|||:....|:..:.| :.:|..:|    ...|.
 Frog   302 GVSAASSIAPQTFLRPPVTVQSALMSHQPLALSRSTAAIGPILSVPTNLISGQFLP----TAAAA 362

  Fly   306 VAGLPA 311
            ||..||
 Frog   363 VAKWPA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 56/87 (64%)
foxd3NP_001011383.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 3/12 (25%)
Forkhead 92..177 CDD:365978 54/84 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4152
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.990

Return to query results.
Submit another query.