DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxj1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_012827170.1 Gene:foxj1 / 496834 XenbaseID:XB-GENE-853648 Length:512 Species:Xenopus tropicalis


Alignment Length:241 Identity:80/241 - (33%)
Similarity:107/241 - (44%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            ||||||.:|..||:.:|.:..:.||.|||:|||.|.|:|.....||||:|||||.|.|||||||.
 Frog   197 KPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRE 261

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRR-KRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGS 141
            .|.||||.:|.:.||..|...||::.:|| ...::|   ....:.:..|..|.||        ||
 Frog   262 KDEPGKGGFWKIDPQYADRLMNGAMKKRRLPPVQIH---PAFASAQAAASGNSNR--------GS 315

  Fly   142 AAHMSPLDMNNAAAMRLDPLPRSTA---------HMPNSLGPG------VPLPHVM---PASMSG 188
            ...:|   :|:.:...|.....:|.         |..|::..|      .|||..|   |...|.
 Frog   316 PWQLS---VNSESHQLLKEFEEATGEQGWNALGEHGWNAISDGKSHKRKQPLPKRMFKAPRLSSS 377

  Fly   189 -----ADHTNL--------------ADMGLTNLPALTSSEIEGPLS 215
                 .:.|.|              :.|...|..|....|:..|||
 Frog   378 PMLCQEEQTELGSLKGDFDWEVIFDSSMNGVNFSAFEDLEVTPPLS 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 48/87 (55%)
foxj1XP_012827170.1 Forkhead 197..283 CDD:278670 47/85 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.