DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxj1b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008648.1 Gene:foxj1b / 494105 ZFINID:ZDB-GENE-041212-76 Length:442 Species:Danio rerio


Alignment Length:253 Identity:81/253 - (32%)
Similarity:110/253 - (43%) Gaps:32/253 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            ||||||.:|..||:.:|.:..:.||.||.:||:.|.|||.....||||:|||||.|.||:||||:
Zfish   139 KPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQ 203

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRR---KRFKLHKNDKDLLNEELTALANLNR-----FFF 134
            .|.||||.:|.:.||..|||.||...|||   ..|...:..|.|.:...:..:..|:     .| 
Zfish   204 KDEPGKGGFWQIDPQYADMFVNGVFKRRRMPATNFNTQRQSKMLSSPSSSYTSQCNQQMGMGHF- 267

  Fly   135 TTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGL 199
               .|.......|...|..|.:...||..|.....:.|.....|..|....:||.|.| ..|:.:
Zfish   268 ---QGNKRKQDFPKRGNKLARISKSPLLTSDIKTSDVLRGDFDLASVFDDVLSGNDST-FEDLDI 328

  Fly   200 TNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGI 257
            ....:....|:|                  |....|......:||::. ...:|.:||
Zfish   329 NTALSSLGCEME------------------PSSQIHNQSGYSNEDEQA-CAYLEANGI 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 48/87 (55%)
foxj1bNP_001008648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..106
Forkhead 139..225 CDD:278670 47/85 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.