DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008148.1 Gene:foxd1 / 493510 XenbaseID:XB-GENE-488077 Length:329 Species:Xenopus tropicalis


Alignment Length:237 Identity:96/237 - (40%)
Similarity:123/237 - (51%) Gaps:39/237 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||..||:|.|.||:|.:||::||||||:....||||:|||||.||||:|:||.
 Frog    68 KPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 132

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            |..||||.||.|.|::.|||:|||.||||||||..:..:.:|.|....|.            .||
 Frog   133 PGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQQAPELVLREPGHFLP------------ASA 185

  Fly   143 AHMSPLDMNNAAAMRLDPL-PRS-----------TAHMPNSLGPGVPLPHVMPASMSGADHT--- 192
            ....|...  |..::|.|. |.|           ....|.|| |.:..|.:||.:......|   
 Frog   186 YSYGPYSC--AYGIQLQPFHPHSALIAFQQQQQQARQQPPSL-PPMAAPALMPPAAQDLSRTCTF 247

  Fly   193 ---NLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPD 231
               .|:...|.  |:|.|..    .|...:.:|:|||:|..|
 Frog   248 YPHQLSPAALP--PSLQSKS----SSALARSTFSIESIIGGD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
foxd1NP_001008148.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63
Forkhead 68..153 CDD:365978 53/84 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4152
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.