DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxj1.2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008143.1 Gene:foxj1.2 / 493505 XenbaseID:XB-GENE-919738 Length:371 Species:Xenopus tropicalis


Alignment Length:249 Identity:82/249 - (32%)
Similarity:104/249 - (41%) Gaps:65/249 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQ--------KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRW 57
            :|.||.....|.        ||||||.:|..||:.:|.::.|.||.||.:||..|.|||.....|
 Frog    89 LPTPSPSPVQEVDYRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSW 153

  Fly    58 QNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEE 122
            |||:|||||.|.||:||||..|.||||.:|.:.|:..|||.||.|.|||.               
 Frog   154 QNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRM--------------- 203

  Fly   123 LTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMS 187
                              .|:|:.|...|.|           .||.| .|....|..|.|.....
 Frog   204 ------------------PASHLDPPRCNKA-----------IAHHP-YLPVSRPSSHHMQHISG 238

  Fly   188 GADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDED 241
            |...:...:.....||||.:.|.:|            ::|.||:.|...|..:|
 Frog   239 GHRQSRRYEKPNPVLPALRAPERQG------------DALFTPEDPLQGSNFDD 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 48/87 (55%)
foxj1.2NP_001008143.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..74
COG5025 <61..>262 CDD:227358 75/217 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..99 3/9 (33%)
Forkhead 108..194 CDD:365978 46/85 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..248 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.