DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxc1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:253 Identity:91/253 - (35%)
Similarity:135/253 - (53%) Gaps:43/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:|..:..  .|||||||:|..|||.::|||.:.|:.||:||.:|||:||.|.|.||||:|||||
 Frog    70 PQPQPKDM--VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIRHNLS 132

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK-------LHKNDKDLLNEE-- 122
            .|:||:||||...:||||:||.|.|.:::||||||.||||:|||       ..|.|||.|.:|  
 Frog   133 LNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDRLLKEHH 197

  Fly   123 --LTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPL--PRSTAHMPNSLGPG------VP 177
              ..|.|...|   ..:.|.:.|...    :.:..:|:..:  ...|:..|.::.|.      :.
 Frog   198 GSQPAAAQQQR---QQQQGQAQAEQD----SGSQPVRIQDIKTENGTSSPPQAMSPALSTVPKIE 255

  Fly   178 LPHVMPASMSGADHTNLADMGLTNLPALTSSEIEGPLSLRP------KRSFTIESLIT 229
            .|....:..||:.|         ::|:..|..:|...|..|      .:.|::::::|
 Frog   256 SPDSSSSMSSGSPH---------SIPSNRSMSLEAAESHHPHQQHHHSQGFSVDNIMT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 54/87 (62%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 51/84 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 28/146 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.