DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and fd96Cb

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_524496.1 Gene:fd96Cb / 43011 FlyBaseID:FBgn0004898 Length:271 Species:Drosophila melanogaster


Alignment Length:251 Identity:122/251 - (48%)
Similarity:155/251 - (61%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||||.:.|||:|||||||||||||||..||:::||||:||:||.|:||:||||||:|||||||||
  Fly     1 MPRPLKMSYGDQKPPYSYISLTAMAIIHSPQRLLPLSEIYRFIMDQFPFYRKNTQKWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALAN-- 128
            |||||||||||...:.|||:||.|||.|||||||||||||||||::.:.:||:.|.:|.|.||  
  Fly    66 SFNDCFIKVPRNVTKAGKGSYWTLHPMAFDMFENGSLLRRRKRFRVKQLEKDISNWKLAAAANTE 130

  Fly   129 ---------LNRFFFT--TRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVM 182
                     |.:..|.  .|:|    |:    :.||:|.::.|...:              |.::
  Fly   131 MVTHYLDDQLTQMAFADPARHG----HV----LANASAAQMSPYKAT--------------PPIL 173

  Fly   183 PASMSGADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSE 238
            |.:             :|.|||            ||||:||||||:.||....|:|
  Fly   174 PTT-------------VTQLPA------------RPKRAFTIESLMAPDPASTPNE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 68/87 (78%)
fd96CbNP_524496.1 FH 13..101 CDD:214627 68/87 (78%)
Alpha_kinase 106..>194 CDD:295997 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445546
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 1 0.900 - - E2759_KOG3562
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 187 1.000 Inparanoid score I3906
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - mtm6425
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.