DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxc2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:413 Identity:128/413 - (30%)
Similarity:187/413 - (45%) Gaps:105/413 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||.::|:|.:.|:.||:||.||||:||:|.|.||||:|||||.|:||:||||.
 Frog    71 KPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRD 135

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK---------------------------LHKND 115
            ..:||||:||.|.|.:::||||||.||||:|||                           |.|:|
 Frog   136 DKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQGKVQGPIPSLELPKHD 200

  Fly   116 KDLL----NEELTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPN-SLGPG 175
            |.::    :.||..:..:...   :.:||||...|               |||.|..|: |....
 Frog   201 KKIVIKSESPELPVITKVENL---SPDGGSAMQDS---------------PRSVASTPSVSTENS 247

  Fly   176 VPLPHVMPASMSGADHTNLADM------GLTNLPAL----------------TSSEIEGPL---S 215
            :|..|  ||| :|....|:..:      .|:.:||:                |.|.:....   |
 Frog   248 IPDQH--PAS-NGFSVENIMTLRTSPHGDLSPVPAVPCRTGMVPSLPINYTQTQSSVYSQACTQS 309

  Fly   216 LRPKRSFTIE----SLITPDKPEH---PSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSA 273
            :....|:...    ||.|.|:|.|   ||..|:...|..:......:.:|    ..:..|..:::
 Frog   310 MDTSGSYQCSMRAMSLYTGDRPSHMCAPSTLEEATSDHHNGTASPLNSMS----LGSGQESVLTS 370

  Fly   274 SRSSRTE---DPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHPLFMMAAP 335
            |...:|.   ....|.: :|.||.:..|   :|.|. |......||   ..|:..||.|.:.::.
 Frog   371 SHHQQTATGGQTAAPWY-LNPGADISHL---SGHNF-GSQQQTFPN---VREMFNSHRLGIESSA 427

  Fly   336 IANMHNIYYNNVTLVAPAQQYRS 358
            ::. |.: ..|.:...|   |||
 Frog   428 LSE-HQV-SGNTSCQIP---YRS 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 54/87 (62%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.