DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_998078.2 Gene:foxd1 / 405849 ZFINID:ZDB-GENE-040426-2094 Length:343 Species:Danio rerio


Alignment Length:356 Identity:115/356 - (32%)
Similarity:155/356 - (43%) Gaps:90/356 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQ------KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLR 62
            |:|:.|...      |||||||:|..|||..||:|.|.||:|..||::||||||:....||||:|
Zfish    59 PARDPYKPASKNTLVKPPYSYIALITMAILQSPKKRLTLSEICDFISNRFPYYREKFPAWQNSIR 123

  Fly    63 HNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALA 127
            ||||.||||:|:||.|..||||.||.|.|::.|||:|||.|||||||| .:...:||.|....|.
Zfish   124 HNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFK-RQQAPELLREHGGFLP 187

  Fly   128 NLNRFFFTTRNGGSAAHMSPLDMNNA------AAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASM 186
            :...:.:.....|....:.....::|      ...:..|..|:|       |..:|.|.:||.:.
Zfish   188 SAAAYGYGPYGCGYGLQLQSYHAHSALLAFQQQQQQQPPPSRNT-------GTLIPAPSLMPTTT 245

  Fly   187 SGADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDV 251
            .                 ||.|....|||  |..|.::::  ....|.|.|.        ..||.
Zfish   246 E-----------------LTRSRFYPPLS--PGISSSLQT--AAKSPVHRSP--------FSIDS 281

  Fly   252 VECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPN 316
            :..|.:|     |..|.   .|||:|.....|||               |..|..:..|..|:.:
Zfish   282 IIGSSLS-----PTHSH---CASRTSPVVPVLPP---------------ALAAQHSPNPLLGVLH 323

  Fly   317 SPTTYELAISHPLFMMAAPIANMHNIYYNNV 347
            .||                  ::|..|.|.:
Zfish   324 GPT------------------SLHETYSNRI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
foxd1NP_998078.2 Forkhead 74..160 CDD:278670 54/85 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.