DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxq1b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_998072.1 Gene:foxq1b / 405843 ZFINID:ZDB-GENE-040426-2090 Length:283 Species:Danio rerio


Alignment Length:328 Identity:89/328 - (27%)
Similarity:127/328 - (38%) Gaps:109/328 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|.||||..|....|.|::|.:::..:||::|.:...|:||:|||||.||||:||.|.
Zfish    45 KPPYSYIALIAMAIRDSNTGRLTLAEINEYLMKKFPFFRGSYTGWRNSVRHNLSLNDCFLKVLRD 109

  Fly    78 PDRP-GKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGS 141
            |.|| ||..||.|:|.:...|.:|...|||||.     .|.:|                    ||
Zfish   110 PSRPWGKDNYWMLNPHSEYTFADGVFRRRRKRI-----SKKIL--------------------GS 149

  Fly   142 AAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALT 206
            |..                                  |..:||..|             .|||..
Zfish   150 AES----------------------------------PERVPADDS-------------RLPARD 167

  Fly   207 SSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYM 271
            .|      ..:...||.|:|:::  ||....|...|:         .|.|.:|  ...:|:..::
Zfish   168 ES------VSKFSSSFAIDSILS--KPFMRREQSTDD---------TCFGTTR--LMMSAAPHFL 213

  Fly   272 SASRSSRTEDPLPPMHTINAGAHV----PFLHYATG-----ANVAGLPAS--GIPNSPTTYELAI 325
            ..:..      .||.......:.|    |.....|.     :.:|.:.:|  |:.:|.||.:.|.
Zfish   214 PVAMG------FPPQSRFQVSSEVSNVFPIYRCNTADISNISRMADIQSSLPGLAHSHTTLQEAG 272

  Fly   326 SHP 328
            .||
Zfish   273 FHP 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 44/88 (50%)
foxq1bNP_998072.1 FH 45..134 CDD:214627 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.