DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and croc

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_524202.1 Gene:croc / 40374 FlyBaseID:FBgn0014143 Length:508 Species:Drosophila melanogaster


Alignment Length:353 Identity:113/353 - (32%)
Similarity:158/353 - (44%) Gaps:83/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|.||||.::.:|.:.|:.||::|.:||||||.|.|.||||:|||||.|:||:||.|.
  Fly    70 KPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARD 134

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTAL---ANLNRFFFTTRNG 139
            ..:||||:||.|.|.:::||:|||.||||:|||    .||::.|:..|:   |.:|.        
  Fly   135 DKKPGKGSYWTLDPDSYNMFDNGSFLRRRRRFK----KKDVMREKEEAIKRQAMMNE-------- 187

  Fly   140 GSAAHMSPLDMNNAAAMRLDPLPRSTAHMPN----SLG--PGVPLPHVMPASMSGADHTNLADMG 198
             ..|.|.||.:.....:....:....||...    .||  .|..:.|   |:|..:.|.:||.|.
  Fly   188 -KLAEMKPLKLMTNGILEAKHMAAHAAHFKKEPLMDLGCLSGKEVSH---AAMLNSCHDSLAQMN 248

  Fly   199 LTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPE--------HPSEDEDDEDDRVDIDVVECS 255
                 .|....:|.|       .||::||:....|.        |.:||        ::..|..|
  Fly   249 -----HLAGGGVEHP-------GFTVDSLMNVYNPRIHHSAYPYHLNED--------NLATVASS 293

  Fly   256 GISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTT 320
            .:.......||..........:....||.|                 |...||..:||  :||||
  Fly   294 QMHHVHHAAAAHHAQQLQRHVAHVAHPLTP-----------------GGQGAGGQSSG--HSPTT 339

  Fly   321 YELAISHPLFMMAAPIANMHNIYYNNVT 348
                       ::.|....|..:|...|
  Fly   340 -----------ISTPHGPAHGGWYTPET 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
crocNP_524202.1 Forkhead 70..156 CDD:278670 50/85 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445549
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.