DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxa1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_989419.1 Gene:foxa1 / 395059 XenbaseID:XB-GENE-487352 Length:428 Species:Xenopus tropicalis


Alignment Length:298 Identity:107/298 - (35%)
Similarity:147/298 - (49%) Gaps:49/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDC 70
            |.||...|||||||||..|||..:|.|||.||:||::|.|.|.|||:|.||||||:||:||||||
 Frog   151 RRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFLYYRQNQQRWQNSIRHSLSFNDC 215

  Fly    71 FIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKND---------KDLLNEELTAL 126
            |:||.|.||:||||:||.|||.:.:|||||..|||:||||..|..         ||:....    
 Frog   216 FVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQQGGKGSQDGRKDVSGPS---- 276

  Fly   127 ANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADH 191
            :.|:|.     :|.|:...|...|:|.::.     |:|..|..::   |...|.|.......:.|
 Frog   277 SPLHRV-----HGKSSQMDSSSSMSNPSSS-----PQSLEHNGSN---GEMKPQVAAGPSPLSSH 328

  Fly   192 TNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSG 256
            .|.:...|.:   .|...::|.........|:|.:|::..:.:|          ::|....| ..
 Frog   329 QNHSTHSLAH---ETHIHLKGDPHYSFNHPFSINNLMSSSEQQH----------KLDFKAYE-QA 379

  Fly   257 ISRY-------PTTPAASEEYMSASRSSRTEDPLPPMH 287
            :.:|       |..|..|..  .|.|.|.....|.|.:
 Frog   380 LQQYSSYSGGLPGMPLGSPS--MAGRGSIEPSALEPTY 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 60/87 (69%)
foxa1NP_989419.1 Forkhead_N 17..157 CDD:369872 3/5 (60%)
FH 158..246 CDD:214627 60/87 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..337 18/96 (19%)
HNF_C 354..417 CDD:370449 15/75 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.