DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxi1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_988949.1 Gene:foxi1 / 394546 XenbaseID:XB-GENE-494125 Length:373 Species:Xenopus tropicalis


Alignment Length:254 Identity:91/254 - (35%)
Similarity:123/254 - (48%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHN 64
            :|.||:|...: .:|||||.:|.||||..:|:|.|.||.||:::.|.||:|.|:...||||:|||
 Frog   110 LPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHN 174

  Fly    65 LSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANL 129
            ||.||||.||||..|.||||.||.|.|....||:||:..|:|||    |:|              
 Frog   175 LSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR----KSD-------------- 221

  Fly   130 NRFFFTTRNGGSAAHM---SPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMP------AS 185
                 .:.||..::..   |||:.:.......|.|..|:....:|.....|.|.:.|      :|
 Frog   222 -----VSPNGQISSDKPEGSPLNESPKNGEHHDMLGNSSPGTDDSSEKRSPPPSITPCLNNFLSS 281

  Fly   186 MSGADHTNLAD-------MGLTNLPA------LTSSEIEGPLSLRPKR-----SFTIES 226
            |:.  :.|.|:       :||||.|:      :.......|||..|..     |.||.|
 Frog   282 MTA--YVNSANPVSRSVPLGLTNEPSDRMGQNMVGLNSYTPLSNMPSHGGSDWSSTISS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
foxi1NP_988949.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Forkhead 123..208 CDD:365978 49/84 (58%)
COG5025 124..>308 CDD:227358 79/208 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..274 19/88 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.