DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxl1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_957278.1 Gene:foxl1 / 393959 ZFINID:ZDB-GENE-040426-1181 Length:363 Species:Danio rerio


Alignment Length:332 Identity:103/332 - (31%)
Similarity:148/332 - (44%) Gaps:47/332 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            ||||||||:|.||||.::|:|...||.||:||.||||||..|.|.||||:|||||.|||||||||
Zfish    51 QKPPYSYIALIAMAIKNAPDKRATLSGIYQFIMDRFPYYHDNKQGWQNSIRHNLSLNDCFIKVPR 115

  Fly    77 RPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGS 141
            ...|||||:||.|..:..||||||:..||:::.:........:..:.|.:.:     |....|..
Zfish   116 EKGRPGKGSYWTLDTKCLDMFENGNYRRRKRKCRTQDTGDTKVGHKRTRVTS-----FKLHQGAQ 175

  Fly   142 AAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALT 206
            :..:|||..|...    |...:|....|.:....|       ||.|..|....:...:.:||..|
Zfish   176 SEKVSPLKQNPGR----DIKEKSNDTQPQNEEENV-------ASESAKDWCLASSTTIVSLPRCT 229

  Fly   207 SSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPA----AS 267
            :          |:||.|:.::.........|..|.....:.|....:........:.|.    .:
Zfish   230 T----------PERSSTVSTVAVNTHTPLSSASETRVPVKSDTGRAQSGDAKSKESNPRKTTDKA 284

  Fly   268 EEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHP-LFM 331
            :|:...|..|:.|:..........||.|....||..:::                :|.:|| |:.
Zfish   285 KEFSIDSILSKKENQFQRRCAAAGGASVDSRGYALASSL----------------IAHAHPQLYP 333

  Fly   332 MAAPIAN 338
            ...|:.:
Zfish   334 RGFPLCS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 59/87 (68%)
foxl1NP_957278.1 FH 52..140 CDD:214627 59/87 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.