DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FoxK

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001261701.1 Gene:FoxK / 39252 FlyBaseID:FBgn0036134 Length:760 Species:Drosophila melanogaster


Alignment Length:369 Identity:97/369 - (26%)
Similarity:136/369 - (36%) Gaps:101/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYG-EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQR-WQNSLRHNLS 66
            ||..||. .:||||||..|...||.::|:|.|.||.||.||...:|||||.|.: ||||:|||||
  Fly   443 PSTASYNHNEKPPYSYAQLIVQAISAAPDKQLTLSGIYSFIVKHYPYYRKETNKGWQNSIRHNLS 507

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNR 131
            .|..||||.|..|.||||::|.:.|.:.....:.|..:||:|                       
  Fly   508 LNRYFIKVARSQDEPGKGSFWRIDPDSGAKLIDHSYKKRRQR----------------------- 549

  Fly   132 FFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLAD 196
                    .|.....|..|..:|       |.|.:||.||                 .:.:.|.|
  Fly   550 --------SSQGFRPPYGMPRSA-------PVSPSHMDNS-----------------RESSPLQD 582

  Fly   197 MGLTNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYP 261
            :.|.:.|......:|       :|:...| :|...:..|..:.:..:.             .:..
  Fly   583 IVLQSAPGSPGMSLE-------QRAADPE-IIYNSQNAHQQQQQQQQQ-------------QQQQ 626

  Fly   262 TTPAASEEYMSASRSSRTEDPLPPMHTIN--AGAHVPFLHYATGANVAGLPASGIPNSPTTYELA 324
            |....|.:|.|.|          |.:..|  :|...|..|....|...|....|:...     ||
  Fly   627 TLSNNSNQYSSGS----------PYYVTNQSSGVATPQTHVEGSAASGGGGGGGVGAL-----LA 676

  Fly   325 ISHPLFMMAAPIANMHNIYYNNVTLVAPAQQYRSPEVQNRIDND 368
            :.....|...  |:.|.::...    |.|||..|..:...:..|
  Fly   677 LKRNHVMGGG--ASQHTLHQQQ----AVAQQQHSEIIYEELPTD 714

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 46/88 (52%)
FoxKNP_001261701.1 FHA <170..253 CDD:238017
Forkhead 453..540 CDD:278670 46/86 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445551
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.