DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and bin

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster


Alignment Length:385 Identity:99/385 - (25%)
Similarity:146/385 - (37%) Gaps:96/385 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            :||..|||::...||..||...|.||:||.::...:.::|.....|:||:|||||.|:||.|:|:
  Fly   310 EKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPK 374

  Fly    77 --RPDRPGKGAYWALHPQAFDMFENGSLLRRRKR----------FKLHKN--------DKDLLNE 121
              ...:||||.||.:...:..:||:...||||.|          :..|.|        |..:.|.
  Fly   375 GMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNG 439

  Fly   122 ELTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNS---LGPGV-PLPHVM 182
            ...|......:.:   :...|..:||......|    ||.....||..:|   :|.|| |||   
  Fly   440 NYYASPAFASYDY---SAAGATGVSPAGGQGFA----DPWNAHAAHSGSSSVGVGMGVGPLP--- 494

  Fly   183 PASMSGADHTN---LADMGLTNLPALTSSEIEGPLSLRPKRS---------FTIE-------SLI 228
                   .:||   ||..|..|..|.|.......|.:.|..|         .|::       ||:
  Fly   495 -------QYTNISCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLV 552

  Fly   229 TPDKPEHPSEDEDDEDDRVDIDVVECSGIS-------------------RYPTTPAASEE-YMSA 273
            ........|....|...| .|.:.:..|:|                   .:.:.|:.|.: :.|.
  Fly   553 AAGYSYATSAGSLDNGLR-SISLQQLPGLSSIQHAQAQAQAQAHHHHHQHHASHPSHSHQGHGSM 616

  Fly   274 SRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHPLFMMA 333
            .::..|....|| .:.:.|:|             |:..|.|...| .|...||.|..|:|
  Fly   617 HQNHGTSSTTPP-PSQSGGSH-------------GIDHSPIDRKP-AYLPPISPPPMMVA 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 36/89 (40%)
binNP_523950.2 Forkhead 311..399 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.