DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxi3b

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_944600.1 Gene:foxi3b / 387258 ZFINID:ZDB-GENE-031126-4 Length:383 Species:Danio rerio


Alignment Length:324 Identity:106/324 - (32%)
Similarity:147/324 - (45%) Gaps:82/324 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67
            ||:|...: .:|||||.:|.||||..:||:.|.||.||:::.|.||:|.|:...||||:|||||.
Zfish   120 PSQEDLMKLVRPPYSYSALIAMAIHGAPERRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSL 184

  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRF 132
            ||||.||||..|.||||.||.|.|....||:||:..|:|||      ..|.|.|:.::..|    
Zfish   185 NDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKR------KSDSLPEKSSSGGN---- 239

  Fly   133 FFTTRNGGSAAHMSP----LDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTN 193
                .:|.|....||    :|::.:.  ...|.|.||       ||...|.:.: ..|||.    
Zfish   240 ----ESGDSNGRGSPKSQSIDISTSP--EKGPSPAST-------GPSPCLSNFL-TEMSGV---- 286

  Fly   194 LADMGLTNLPALTSSEIEG-PLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGI 257
                      |..|.::|. |||    |.||:.  :..|..:..|               :.:|.
Zfish   287 ----------AAGSLDMEADPLS----RPFTLS--LPVDGAQRAS---------------QTTGF 320

  Fly   258 SRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAG-AHV------PFLHYATGANVAGLPASGI 314
            |.:  ||:.:        .|....||||...:::. :|.      |.|....|....||.::||
Zfish   321 STF--TPSTT--------VSDWASPLPPPPPMSSSPSHSTLAYSGPVLSQFNGHFFPGLSSTGI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 51/87 (59%)
foxi3bNP_944600.1 FH 130..218 CDD:214627 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.