DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxi3a

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:215 Identity:78/215 - (36%)
Similarity:107/215 - (49%) Gaps:35/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGE-QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSF 67
            ||:|...: .:|||||.:|.||||..:|.:.|.||.||:::.|.||:|.|:...||||:|||||.
Zfish   106 PSQEDLMKLVRPPYSYSALIAMAIHGAPNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRHNLSL 170

  Fly    68 NDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRF 132
            ||||:||||....||||.||.|.|....||:||:..|:|||    |:| .|..||....      
Zfish   171 NDCFMKVPRDDSDPGKGNYWTLDPNCEKMFDNGNFRRKRKR----KSD-SLAEEEGKGY------ 224

  Fly   133 FFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADM 197
                 :|..:|..||.:.::::.....|:....|...||.                  ...:.|:
Zfish   225 -----SGSDSALSSPKNPSDSSERGNSPISTDQAPCLNSF------------------LNQMGDV 266

  Fly   198 GLTNLPALTSSEIEGPLSLR 217
            ...:..||..|.:..|||.|
Zfish   267 ASGSREALLPSPLAVPLSQR 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 49/87 (56%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 49/87 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.