DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FoxL1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:294 Identity:100/294 - (34%)
Similarity:135/294 - (45%) Gaps:82/294 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFI 72
            |:..:|||:|||:|.||||.|:|.:.|.||.|||||.|:|||||:|.|.||||:|||||.||||:
  Fly    86 SHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMDKFPYYRENKQGWQNSIRHNLSLNDCFV 150

  Fly    73 KVPRRP------DRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLH--------------KNDKD 117
            |:||..      |..|||:||.|...|.||||.|:..|||.|.:.|              .||.:
  Fly   151 KIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRRRRTRRQRHCGHPNRYERESGKDSNDGN 215

  Fly   118 LLNEELTA---------------------LANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPL 161
            ....|:.:                     :.:|:|.:.:...|     .:.|..|.|..:|  ||
  Fly   216 SSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLHRQYLSVSLG-----FNSLFNNEARGLR--PL 273

  Fly   162 P-------------------------RSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTN 201
            |                         ....|.|::..|  || :....|.|||.....|..|:.:
  Fly   274 PEIRECPDDVDASSSSSKAMQSSMELHEELHSPSAFTP--PL-NRRETSSSGAPVLAEAFNGIKD 335

  Fly   202 -LPALTSSEIEGPLSLRPKRS-FTIESLITPDKP 233
             :.|..||.:..  |.|.|.: |||:::|  .||
  Fly   336 VVDAPGSSPVAS--SNRSKTTLFTIDNII--GKP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 57/93 (61%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 57/93 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445475
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.