DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and fd59A

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_523814.1 Gene:fd59A / 37631 FlyBaseID:FBgn0004896 Length:456 Species:Drosophila melanogaster


Alignment Length:363 Identity:109/363 - (30%)
Similarity:141/363 - (38%) Gaps:117/363 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||..||.|.|.||.|..||..|||||:.....||||:|||||.|||||||||.
  Fly    85 KPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPRE 149

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFK------------------------------LH 112
            |..||||.:|.|.|.|.|||:|||.||||||:|                              :|
  Fly   150 PGNPGKGNFWTLDPLAEDMFDNGSFLRRRKRYKRAPTMQRFSFPAVFGTLSPFWIRKPVPLVPVH 214

  Fly   113 ---------------KNDKDLLNEELTA------LANLNRFFFTTRNGGSAAHMSPLDMNNAAAM 156
                           .|..|:.:..|.|      .||....|:.....|......|.......|.
  Fly   215 FNVPNFNGSREFDVVHNPADVFDSALRADKKFNFFANAEASFYQGSQSGDKFDRLPFMNRGRGAD 279

  Fly   157 RLDPLPRSTAH-------MPNSLGPGVPLPHVMP----ASMSG-ADHTNLA----------DMGL 199
            .||.||.|:..       ..:|.|.....|:...    ||.:| ..|.:.|          |:.:
  Fly   280 VLDALPHSSGSGGGVGGGSESSRGSKYKSPYAFDVATVASAAGIPGHRDYAERLSAGGGYMDLNV 344

  Fly   200 TNLPALTSSEIEGPLSLRPKRSFTIESLITPDKPEHPSEDEDDE-DDRVDI------------DV 251
            .|..|.|.::.|                         :|.:||. :|::|:            |.
  Fly   345 YNDDADTEADAE-------------------------AEGDDDSCEDKIDVESGNEQEDSHISDS 384

  Fly   252 VECSGISRYPTTP------AASEEYMSASRSSRTEDPL 283
            |:.:..:|....|      |::|...|:.|.....:||
  Fly   385 VDSACTNRLDAPPEALIFEASAEASDSSPRRRFDSEPL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 56/87 (64%)
fd59ANP_523814.1 Forkhead 85..171 CDD:278670 55/85 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445487
Domainoid 1 1.000 98 1.000 Domainoid score I1601
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.