DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxb1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001013266.2 Gene:Foxb1 / 367106 RGDID:1305217 Length:325 Species:Rattus norvegicus


Alignment Length:314 Identity:140/314 - (44%)
Similarity:162/314 - (51%) Gaps:87/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNL 65
            ||||.|.:|.:|||||||||||||||.||||||||||:|||||.|||||||:|||||||||||||
  Rat     1 MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNL 65

  Fly    66 SFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKND----------KDLLN 120
            ||||||||:|||||:||||::|||||...|||||||.||||||||:.|:|          ...|.
  Rat    66 SFNDCFIKIPRRPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQ 130

  Fly   121 EE----LTALA----NLNRFFFTTRNGGSAAHMS----PLDMNNAAAMRLD-------------- 159
            ::    |:|||    :|.:......|.|..|..|    |..:.|..|....              
  Rat   131 QQAKLRLSALAASGTHLPQMPAAAYNLGGVAQPSGFKHPFAIENIIAREYKMPGGLAFSAMQPVP 195

  Fly   160 ---PLPRSTAHMPNSLGPGVPLPHV----------MPASMSGADH-------------------- 191
               |||.....|.:|||.|  .|||          .|.||:..|:                    
  Rat   196 AAYPLPNQLTTMGSSLGTG--WPHVYGSAGMIDSATPISMASGDYSAYGVPLKPLCHAAGQTLPA 258

  Fly   192 -------TNLADMGLTNLPA-----LTSSEIEGPLSLRPKRSFTIESLITPDKP 233
                   |..|...|..|||     |::|    |.||.|..|.|..|..:|..|
  Rat   259 IPVPIKPTPAAVPALPALPAPIPTLLSNS----PPSLSPTSSQTATSQSSPATP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 76/87 (87%)
Foxb1NP_001013266.2 FH_FOXB2 1..110 CDD:410817 91/108 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1236900at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106709
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.