DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxc1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:318 Identity:103/318 - (32%)
Similarity:131/318 - (41%) Gaps:85/318 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRP----SRESYGEQ----------------------KPPYSYISLTAMAIWSSPEKMLPLSDI 39
            ||.|    |..::.||                      |||||||:|..|||.::|:|.:.|:.|
  Rat    40 MPAPMSVYSHPAHAEQYPGGMARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGI 104

  Fly    40 YKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLR 104
            |:||.||||:||.|.|.||||:|||||.|:||:||||...:||||:||.|.|.:::||||||.||
  Rat   105 YQFIMDRFPFYRDNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLR 169

  Fly   105 RRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMP 169
            ||:|||.....||  .||...|                 |:.            :|.|......|
  Rat   170 RRRRFKKKDAVKD--KEEKGRL-----------------HLQ------------EPPPPQAGRQP 203

  Fly   170 NSLGP-----GVPLPHVMPASMSGADHTNLADMGLTNLPALTSSEIEGPLSLRPKRSFTIESLIT 229
            ....|     ..|.|...|..:......|    |....|         |..|.|..:....|..|
  Rat   204 APAPPEQAEGSAPGPQQPPVRIQDIKTEN----GTCPSP---------PQPLSPAAALGSGSAAT 255

  Fly   230 PDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMH 287
            ..|.|.|........          ||.|...:.|:|....:.|:..:....|.||.|
  Rat   256 VPKIESPDSSSSSLS----------SGSSPPGSLPSARPLSLDAAEPAPPPQPAPPPH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 54/87 (62%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 54/87 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.