DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXI3

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001129121.1 Gene:FOXI3 / 344167 HGNCID:35123 Length:420 Species:Homo sapiens


Alignment Length:297 Identity:97/297 - (32%)
Similarity:130/297 - (43%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRESYGEQ-KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            |||...:. :|||||.:|.||||.|:||:.|.||.||:|:.|.||:|:::...||||:|||||.|
Human   136 SREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADSFPFYQRSKAGWQNSIRHNLSLN 200

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLL-----NEE------ 122
            |||.||||..|.||||.||.|.|....||:||:..|:|||.....|...:.     :||      
Human   201 DCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSEASNGSTVAAGTSKSEEGLSSGL 265

  Fly   123 ----------------------------------------LTALANLNRFFFTTRNGGSAAHMSP 147
                                                    ||:...||.||         :.:|.
Human   266 GSGVGGKPEEESPSTLLRPSHSPEPPEGTKSTASSPGGPMLTSTPCLNTFF---------SSLSS 321

  Fly   148 LDMNNAAAMRLDPLPRST------AHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTN----- 201
            |.::::.:.: ..||.|.      |.:|:|   ||    ..|.|:|.|....|.....|:     
Human   322 LSVSSSVSTQ-RALPGSRHLGIQGAQLPSS---GV----FSPTSISEASADTLQLSNSTSNSTGQ 378

  Fly   202 -------LPALTSSEIEGPLSLRPKRSFT-IESLITP 230
                   .||.||.....|.| .|..:|: :.|||.|
Human   379 RSSYYSPFPASTSGGQSSPFS-SPFHNFSMVNSLIYP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
FOXI3NP_001129121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..122
Forkhead 145..231 CDD:278670 51/85 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..306 7/71 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..396 6/31 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.