DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and slp1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster


Alignment Length:195 Identity:75/195 - (38%)
Similarity:98/195 - (50%) Gaps:31/195 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPR 76
            :||||||.:|..|||..|||:.|.|:.||:::.:||||::.|.:.||||:|||||.|.||.|:||
  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183

  Fly    77 RPDRPGKGAYWALHPQAFDMF--ENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFT---- 135
            ..|.||||.||.|.|.|.::|  |....|||       ||.    ....|.||...:..|:    
  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRR-------KNP----GASRTRLAAYRQAIFSPMMA 237

  Fly   136 -TRNGGSAAHMS----PLDMNNAAAM--RLDPLPRSTAH--MPNSLGPGV---PLPHVMPASMSG 188
             :..|..|:...    |.....|||:  |::|.....|:  |.....|..   ..||  ||.|.|
  Fly   238 ASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPH--PAQMQG 300

  Fly   189  188
              Fly   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 49/89 (55%)
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445508
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.