DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxk1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_956196.1 Gene:foxk1 / 334470 ZFINID:ZDB-GENE-030131-6402 Length:639 Species:Danio rerio


Alignment Length:393 Identity:99/393 - (25%)
Similarity:151/393 - (38%) Gaps:111/393 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVP 75
            |.||||||..|...||.|:.::.|.||.||..||..:||||...:.||||:|||||.|..|||||
Zfish   256 ESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVP 320

  Fly    76 RRPDRPGKGAYWALHPQAFDMFENGSLLRRRKR----FK--------------------LHKNDK 116
            |..:.||||::|.:.|.:.......:..:||:|    |:                    |..:..
Zfish   321 RSQEEPGKGSFWRVDPSSEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHSGLLSPHSS 385

  Fly   117 DLLNEEL---------------TALANLNRFFFTTRNGGSAAHMSPLDM----NNAAAMRLDPLP 162
            .|...|.               :.||::..:.::....||.....|:.|    .::||     :.
Zfish   386 GLQTPECLSREGSPVSHEHDFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPSQSSAA-----IS 445

  Fly   163 RSTAHMPNSL---------------GPGVPLPHVMPASMSGADHTNLADMGLTNLPALTSSEIEG 212
            :..|:||:.:               .|.|.:..|:..|.|..:...||:         |||...|
Zfish   446 KPVAYMPSIISSSQASGQAIHVVQQAPAVTMVRVVTTSTSSPNGYILAN---------TSSSGPG 501

  Fly   213 PLSLRPKRSFTIESLITPDKPEHPSEDEDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSS 277
            .|...|:.:.                   ||...|...|::..| |...:.....:.|....:|:
Zfish   502 DLHGDPRGAL-------------------DEMPLVGSRVIQAVG-SHIASANRGQQSYTVVQQSA 546

  Fly   278 RTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGIPNSPTTYELAISHPLFMMAAPIANMHNI 342
                    :|      |:|....|.....| ||.:.||.|    ..|:::||.::||..:....:
Zfish   547 --------IH------HLPVQTIAQNGKHA-LPVTSIPTS----AYALTNPLQILAAQASTSPPV 592

  Fly   343 YYN 345
            ..|
Zfish   593 LVN 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 43/87 (49%)
foxk1NP_956196.1 FHA 23..165 CDD:224630
FHA 68..152 CDD:238017
Forkhead 258..344 CDD:278670 43/85 (51%)
Cyto_heme_lyase 370..>465 CDD:279589 14/99 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.