DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and fd19B

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:95 Identity:53/95 - (55%)
Similarity:62/95 - (65%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            ||.::|.:|..||||||.||.|.||.|.|:|.|.|||||.....||||:|||||.|..|::|||.
  Fly    58 KPAFTYSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRA 122

  Fly    78 PDRPGKGAYWALHPQAFDMF--ENGSLLRR 105
            .|.||:|.||||.|.|.|:.  |....|||
  Fly   123 LDDPGRGHYWALDPYAEDLSIGETTGRLRR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 50/89 (56%)
fd19BNP_608369.1 FH 58..135 CDD:238016 45/76 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445530
Domainoid 1 1.000 104 1.000 Domainoid score I1720
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm46522
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.