DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxk2a

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001184186.1 Gene:foxk2a / 324141 ZFINID:ZDB-GENE-030131-2861 Length:544 Species:Danio rerio


Alignment Length:352 Identity:95/352 - (26%)
Similarity:137/352 - (38%) Gaps:80/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVP 75
            :.||||||..|...||..:|:|.|.|:.||..||..:||||...:.||||:|||||.|..||||.
Zfish   202 DSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVA 266

  Fly    76 RRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGG 140
            |..:.||||::|.:.|.:.....:.:..:||.|      ........|..|::.:.....|..|.
Zfish   267 RSQEEPGKGSFWRIDPSSEGKLMDQAFRKRRPR------GVPCFRTPLGPLSSRSAPASPTHTGV 325

  Fly   141 SAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLA-------DMG 198
            .:||.|.:                  ..|:|...|.|||.....|.:.|....||       ...
Zfish   326 LSAHSSGV------------------QTPDSSREGSPLPLEPEPSAAAAPQPKLAVIQESCFTQN 372

  Fly   199 LTNLPALTSSEIEGPL--SLRPKRSFTIESLITPDKPEHP--------------------SEDED 241
            ....|.|.:  ::.||  ||:|. ||   |:.||.....|                    :|.::
Zfish   373 TPGSPVLIA--VQQPLQQSLKPV-SF---SVATPASSAAPQPVMQTLHLLHQIPAACVFRAEQQN 431

  Fly   242 DEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANV 306
            .:...|.:.|.....::..|  .|:|......:.:.|.:..||.......|.||           
Zfish   432 GDAQEVKVTVEPVPAVAAAP--GASSRVLQPLAVAPRGQHQLPVKPITQNGTHV----------- 483

  Fly   307 AGLPASGIPNSPTTYELAISHPLFMMA 333
               .|:.|..|.:|     :.||.|:|
Zfish   484 ---AAAAIQGSAST-----ASPLHMLA 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 42/87 (48%)
foxk2aNP_001184186.1 FHA 16..105 CDD:238017
Forkhead 204..290 CDD:278670 42/85 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.