DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXA2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:350 Identity:119/350 - (34%)
Similarity:162/350 - (46%) Gaps:66/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:..|.||...|||||||||..|||..||.|||.||:||::|.|.||:||:|.||||||:||:||
Human   154 PKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLS 218

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNR 131
            |||||:||||.||:||||::|.|||.:.:|||||..|||:||||.   :|.|..:|....|.   
Human   219 FNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKC---EKQLALKEAAGAAG--- 277

  Fly   132 FFFTTRNGGSAAHMSPLDMNNAAAMRLD-----PLPRSTA-----HMPNSLG-----PGVPLPHV 181
               :.:...:.|..|...:..||....:     ..|.|:|     |....||     |...|...
Human   278 ---SGKKAAAGAQASQAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPP 339

  Fly   182 MPASMSGADHTNLAD-MGLTNLPALTSSEIEGPLSLRPK------RSFTIESLITPDKPEHPSED 239
            .||...|......|. :|..:.|.|...     ..|:|:      ..|:|.:|::.::..|.|. 
Human   340 EPAPSPGQQQQAAAHLLGPPHHPGLPPE-----AHLKPEHHYAFNHPFSINNLMSSEQQHHHSH- 398

  Fly   240 EDDEDDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGA 304
            ...:..::|:...|  .:..||       .|.|....|....|:                    .
Human   399 HHHQPHKMDLKAYE--QVMHYP-------GYGSPMPGSLAMGPV--------------------T 434

  Fly   305 NVAGLPASGIPNSPTTYELAISHPL 329
            |..||.||.:....:.|:...|.|:
Human   435 NKTGLDASPLAADTSYYQGVYSRPI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 61/87 (70%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 4/9 (44%)
FH_FOXA2 163..264 CDD:410813 69/103 (67%)
HNF_C 380..452 CDD:401339 18/101 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.