DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and FOXA1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_004487.2 Gene:FOXA1 / 3169 HGNCID:5021 Length:472 Species:Homo sapiens


Alignment Length:333 Identity:113/333 - (33%)
Similarity:147/333 - (44%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDC 70
            :.||...|||||||||..|||..:|.|||.||:||::|.|.|||||:|.||||||:||:||||||
Human   163 KRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDC 227

  Fly    71 FIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFT 135
            |:||.|.||:||||:||.|||.:.:|||||..|||:||||..|.                    .
Human   228 FVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQ--------------------P 272

  Fly   136 TRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGP-------------GVPLPHVMPASMS 187
            ...||..:.............|.||   |.|..|::..|             |.|.|. ..||..
Human   273 GAGGGGGSGSGGSGAKGGPESRKDP---SGASNPSADSPLHRGVHGKTGQLEGAPAPG-PAASPQ 333

  Fly   188 GADHTNLADMGLTNLPALTSSEIEGPLS------------------------LRPKRS------- 221
            ..||:.....|       .:||::.|.|                        |.|..|       
Human   334 TLDHSGATATG-------GASELKTPASSTAPPISSGPGALASVPASHPAHGLAPHESQLHLKGD 391

  Fly   222 --------FTIESLITPDKPEHPSEDEDDEDDRVDIDVVE-CSGISRYPTTPAASEEYMSASRSS 277
                    |:|.:|::..:.:|          ::|....| ....|.|.:|..||....|||.::
Human   392 PHYSFNHPFSINNLMSSSEQQH----------KLDFKAYEQALQYSPYGSTLPASLPLGSASVTT 446

  Fly   278 RTEDPLPP 285
            |:  |:.|
Human   447 RS--PIEP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 61/87 (70%)
FOXA1NP_004487.2 Forkhead_N 17..169 CDD:369872 2/5 (40%)
FH_FOXA1 157..268 CDD:410812 70/104 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..392 25/153 (16%)
HNF_C 398..461 CDD:401339 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.