DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxd2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:273 Identity:100/273 - (36%)
Similarity:124/273 - (45%) Gaps:52/273 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQ------KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNS 60
            |.|...|.|..      |||||||:|..|||..||:|.|.||:|.:||:.||||||:....||||
  Rat   114 PGPGPPSGGAATRSPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNS 178

  Fly    61 LRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKL----------HKND 115
            :|||||.||||:|:||.|..||||.||.|.|::.|||:|||.||||||||.          |.:.
  Rat   179 IRHNLSLNDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHPHP 243

  Fly   116 KDLLNEELTALANLNRFF-------------------FTTRNGGSAAHMSP----LDMNNAAAMR 157
            :.||.....|..:...|.                   :.....|.|.|..|    ......|..:
  Rat   244 ELLLRGGAAAAGDPGAFLSGFAAYGAYGYGYGLALPAYGAPPPGPAPHPHPHPHAFAFAATAPCQ 308

  Fly   158 LDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLT--NLPALTSSEIEG------PL 214
            |...|...|..|    ||.|...|..::.|..........|.:  .|||...:|: |      |.
  Rat   309 LSVPPGRAAAPP----PGPPTASVFASATSAPAPAPAPGSGPSPAGLPAFLGAEL-GCAKAFYPA 368

  Fly   215 SLRPKRSFTIESL 227
            ||.|..:.|..:|
  Rat   369 SLSPPAAGTAATL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 55/87 (63%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 64/97 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.