DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and Foxs1

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:336 Identity:105/336 - (31%)
Similarity:140/336 - (41%) Gaps:89/336 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFN 68
            ||.|   ..|||||||:|.||||.|||.:...||.||::|..||.:||.|...||||:|||||.|
  Rat    12 PSTE---PSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLN 73

  Fly    69 DCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFF 133
            :||:||||...:||||:||.|.|...|||::||.||||:||                        
  Rat    74 ECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRF------------------------ 114

  Fly   134 FTTRNGGSAAHMSPLDMN--------------NAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPA 184
              |:..|:.....|:..:              |....||.|.|   ..:||..|.| .|...:||
  Rat   115 --TKRTGAQGTKGPVKADHRPLRATSPDQGAPNTTTGRLCPFP---PEVPNPKGFG-GLMGSLPA 173

  Fly   185 SMSGADHTNLADMGLTNLPALTSSEIEGPLSL------RPKRSFTIESLITPDKPEHPSEDEDDE 243
            :|..........:. |....:.|::..||..|      .|..:|...|..:              
  Rat   174 NMCPTTSDTRPQLP-TGPKDMCSAKSGGPRELSEATSPSPCPAFGFSSAFS-------------- 223

  Fly   244 DDRVDIDVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTIN--AGAHVPFLHYATGANV 306
                     |...:.:.| ||:.:.|.:.:|...|       |.|:|  .||.....|..|.|  
  Rat   224 ---------EAESLGKAP-TPSVAPESIGSSYQCR-------MQTLNFCMGADPGLEHLLTSA-- 269

  Fly   307 AGLPASGIPNS 317
            ...|.|..|::
  Rat   270 VATPGSSTPSA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 52/87 (60%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 51/84 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.