DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxd5

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_571345.1 Gene:foxd5 / 30524 ZFINID:ZDB-GENE-980605-4 Length:321 Species:Danio rerio


Alignment Length:239 Identity:89/239 - (37%)
Similarity:122/239 - (51%) Gaps:53/239 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRR 77
            |||||||:|..|||..||.|.|.||.|..||:::||||::....||||:|||||.||||||:||.
Zfish    73 KPPYSYIALITMAILQSPMKKLTLSGICDFISNKFPYYKEKFPAWQNSIRHNLSLNDCFIKIPRE 137

  Fly    78 PDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKNDKDLLNEELTALANLNRFFFTTRNGGSA 142
            |..||||.||:|.|.:.|||:|||.||||||||  :|..:...:.|.       .:..|.:  ..
Zfish   138 PGNPGKGNYWSLDPASEDMFDNGSFLRRRKRFK--RNQPEFTKDSLV-------LYHPTLS--YR 191

  Fly   143 AHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPHVMPASMSGADHTNLADMGLTNLPALTS 207
            |:..|..::.|...:.:|:    .::|...|..||.|.....:|              |:....:
Zfish   192 AYGRPYCVSGAVPAQTNPV----GYLPVPDGIMVPPPFFQYQTM--------------NIKIHDA 238

  Fly   208 SEIEGPLSLRPKR-----SFTIESL---------------ITPD 231
            .||:    .||:.     ||:|:|:               :|||
Zfish   239 PEIQ----QRPEHKTQRCSFSIDSIMAKSTESSSKSSAHHLTPD 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 54/87 (62%)
foxd5NP_571345.1 Forkhead 73..159 CDD:278670 53/85 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.