DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd96Ca and foxa2

DIOPT Version :9

Sequence 1:NP_001287516.1 Gene:fd96Ca / 43010 FlyBaseID:FBgn0004897 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_571024.1 Gene:foxa2 / 30126 ZFINID:ZDB-GENE-980526-404 Length:409 Species:Danio rerio


Alignment Length:348 Identity:114/348 - (32%)
Similarity:162/348 - (46%) Gaps:102/348 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRPSRESYGEQKPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLS 66
            |:..|.||...|||||||||..|||..||.|||.||:||::|.|.||:||:|.||||||:||:||
Zfish   140 PKTYRRSYTHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLS 204

  Fly    67 FNDCFIKVPRRPDRPGKGAYWALHPQAFDMFENGSLLRRRKRFKLHKN-DKDLLNEELTALANLN 130
            |||||:||||.||:||||::|.|||.:.:|||||..|||:||||..|. .||...:.....:|.:
Zfish   205 FNDCFLKVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCDKKLSKDPSRKTSEGGSNSS 269

  Fly   131 RFFFTTRNGGSAAHMSPLDMNNAAAMRLDPLPRSTAHMPNSLGPGVPLPH-VMPASMS----GAD 190
            .   .:.||..:.|      :|:::   :.|.||.:.|.:  |.|:...| ..|.|.:    ...
Zfish   270 S---ESCNGNESPH------SNSSS---NELKRSLSDMKS--GQGLSPDHAASPTSQAQHLLAQH 320

  Fly   191 HTNLADMGLTNLPALTSSEIEGPLSLRPK------RSFTIESLITPDKPEHPSEDEDDEDDRVDI 249
            |:.||..|                .|:|:      ..|:|.:|::.::..|          ::|:
Zfish   321 HSVLAHEG----------------HLKPEHHYSFNHPFSINNLMSSEQQHH----------KMDL 359

  Fly   250 DVVECSGISRYPTTPAASEEYMSASRSSRTEDPLPPMHTINAGAHVPFLHYATGANVAGLPASGI 314
            ...|                                          ..:||..|:.:||..:.|.
Zfish   360 KTYE------------------------------------------QVMHYGYGSPMAGTLSMGS 382

  Fly   315 P------NSPTT--YELAISHPL 329
            .      :||.|  |:...|.|:
Zfish   383 MASKAGLDSPDTSYYQGVYSRPI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd96CaNP_001287516.1 FH 13..101 CDD:214627 61/87 (70%)
foxa2NP_571024.1 Forkhead_N 18..150 CDD:254796 4/9 (44%)
FH 151..239 CDD:214627 61/87 (70%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 250..315 17/78 (22%)
HNF_C 340..398 CDD:286443 15/109 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.